Bacterial taxon 208964
Protein WP_003093742.1
30S ribosomal protein S7
Pseudomona aeruginosa PA01
Gene rpsG, UniProt Q9HWD1
>WP_003093742.1|Pseudomona aeruginosa PA01|30S ribosomal protein S7
MPRRRVAAKREVLADPKYGSQILAKFMNHVMESGKKAVAERIVYGALDKVKERGKADPLETFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDFARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ 2.39 | 2.39161488992431 | 2.0e-261 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)