Bacterial taxon 208964
Protein WP_003095634.1
30S ribosomal protein S18
Pseudomona aeruginosa PA01
Gene rpsR, UniProt Q9HUN0
>WP_003095634.1|Pseudomona aeruginosa PA01|30S ribosomal protein S18
MARFFRRRKFCRFTAEGVKEIDYKDLNTLKAYVSETGKIVPSRITGTKAKYQRQLATAIKRARYLALLPYTDSHGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ 2.1 | 2.10019270909082 | 1.4e-270 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)