Bacterial taxon 208964
Protein WP_003093744.1
30S ribosomal protein S12
Pseudomona aeruginosa PA01
Gene rpsL, UniProt Q9HWD0
>WP_003093744.1|Pseudomona aeruginosa PA01|30S ribosomal protein S12
MATINQLVRKPRKRMVDKSDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGAKRPK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ 2.23 | 2.23356346447023 | 5.0e-244 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)