Bacterial taxon 208964
Protein WP_003092375.1
3-hydroxyacyl-ACP dehydratase FabZ
Pseudomona aeruginosa PA01
Gene fabZ, UniProt Q9HXY7
>WP_003092375.1|Pseudomona aeruginosa PA01|3-hydroxyacyl-ACP dehydratase FabZ
MMDINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKNVSINEPFFNGHFPEHPIMPGVLIIEAMAQAAGILGFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLQLHAKFISVKRSIWKFDCHATVDDKPVCSAEIICAERKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.74 | 0.736364813696311 | 1.7e-14 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)