Bacterial taxon 208964
Protein WP_003114067.1
3'(2'),5'-bisphosphate nucleotidase CysQ
Pseudomona aeruginosa PA01
Gene cysQ, UniProt Q9HU14
>WP_003114067.1|Pseudomona aeruginosa PA01|3'(2'),5'-bisphosphate nucleotidase CysQ
MRPVPWGELVALVRRAGEAILPHWRADVVVRSKADESPVTAADLAAHHILEAGLRALAPDIPVLSEEDCEIPLSERGHWRRWWLVDPLDGTKEFISGSEEFTVNVALVEDGRVLFGLVGVPVSGRCYYGGAGLGAWREEADGRAQPISVRLEPEEAFTVVASKRHGSPAQERLLDGLSERFGDLRRASIGSSLKFCLLAEGAADCYPRLTPTSQWDTAAAQGVLEGAGGEVLDLHGAPFTYEPREDYLNGSFLALPRAAEWRSELIQLARALH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ -0.47 | -0.468834528265075 | 1.0e-5 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)