Host taxon 10090
Protein NP_510964.1
28S ribosomal protein S21, mitochondrial
Mus musculus
Gene Mrps21, UniProt P58059
>NP_510964.1|Pseudomona aeruginosa PA01|28S ribosomal protein S21, mitochondrial
MAKHLKFIARTVMVQEGNVEGAYRTLNRILTTDGLTEVISRRRYYEKPCRRRQRESYETCRRIYNMEMARKINFLMRKNRADPWLGC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -1 | -0.997209043589505 | 0.003 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)