Host taxon 10090
Protein NP_036015.1
28S ribosomal protein S12, mitochondrial isoform a precursor
Mus musculus
Gene Mrps12, UniProt O35680
>NP_036015.1|Pseudomona aeruginosa PA01|28S ribosomal protein S12, mitochondrial isoform a precursor
MSWPGLLYGLTTSLSRGLALAPQLWAARSMATLNQMHRLGPRKEPPKRLGPTEGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTGKEAVCFIPGEGHTLQEHHVVLVEGGRTQDLPGVKLKVVRGKYDCGHVQKKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.16 | -2.15622545779656 | 5.9e-8 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)