Host taxon 10090
Protein NP_033195.1
26S proteasome complex subunit SEM1
Mus musculus
Gene Sem1, UniProt P60897
>NP_033195.1|Pseudomona aeruginosa PA01|26S proteasome complex subunit SEM1
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.88 | 0.882707052055845 | 5.7e-6 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)