Bacterial taxon 208964
Protein WP_003092359.1
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Pseudomona aeruginosa PA01
Gene ispD, UniProt P57707
>WP_003092359.1|Pseudomona aeruginosa PA01|2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
MTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.17 | 1.16731806691762 | 6.7e-17 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)