Host taxon 10090
Protein NP_598813.1
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Mus musculus
Gene Adi1, UniProt Q99JT9
>NP_598813.1|Pseudomona aeruginosa PA01|1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRNYSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISMEKGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.58 | -1.58230835661432 | 6.9e-9 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)