Host taxon 9606
Protein NP_001013276.1
zinc finger protein 789 isoform 2
Homo sapiens
Gene ZNF789, UniProt Q5FWF6
>NP_001013276.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|zinc finger protein 789 isoform 2
MFPPARGKELLSFEDVAMYFTREEWGHLNWGQKDLYRDVMLENYRNMVLLVYFQFDAAIPLC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.61 | 0.606617975732302 | 0.013 | 25649146 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)