Host taxon 9606
Protein NP_001009958.1
zinc finger protein 655 isoform c
Homo sapiens
Gene ZNF655, UniProt Q8N720
>NP_001009958.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|zinc finger protein 655 isoform c
MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGGILLRLPTTRIHSVNSCPALSHTQASAFSGETLAVLTAGISKRWPKYRLPIDIARPCSETPFPRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.84 | 0.837051997978505 | 2.8e-5 | 25649146 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)