Host taxon 9606
Protein NP_001153655.1
zinc finger protein 138 isoform 2
Homo sapiens
Gene ZNF138, UniProt P52744
>NP_001153655.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|zinc finger protein 138 isoform 2
MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFLDLITCLEQGKEPWNMKRHEMVVAKHSAVAFTFDLSGLNILSFQSILPFVSALYVMGNRNQCLQKHLEARNKDLCVLVLPKTFG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.22 | 1.22288461879702 | 2.8e-5 | 25649146 | |
Retrieved 1 of 5 entries in 1.3 ms
(Link to these results)