Host taxon 9606
Protein NP_004772.1
vesicle-associated membrane protein 3
Homo sapiens
Gene VAMP3, UniProt Q15836
>NP_004772.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|vesicle-associated membrane protein 3
MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.79 | 0.787342149672328 | 0.026 | 25649146 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)