Host taxon 9606
Protein NP_001185838.1
V-type proton ATPase subunit F isoform 2
Homo sapiens
Gene ATP6V1F, UniProt Q16864
>NP_001185838.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|V-type proton ATPase subunit F isoform 2
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRSLGSLPGSVVEANPNQRDPPLWDEIDSRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.7 | -0.695133201325678 | 0.00025 | 25649146 | |
Retrieved 1 of 2 entries in 1.5 ms
(Link to these results)