Host taxon 9606
Protein NP_001093253.1
UPF0462 protein C4orf33
Homo sapiens
Gene C4orf33, UniProt Q8N1A6
>NP_001093253.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|UPF0462 protein C4orf33
MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDITEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRMSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.96 | 1.96409203840874 | 8.0e-7 | 25649146 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)