Host taxon 9606
Protein NP_998773.2
uncharacterized protein C2orf66 precursor
Homo sapiens
Gene C2orf66, UniProt Q6UXQ4
>NP_998773.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|uncharacterized protein C2orf66 precursor
MTRAPLLLLCVALVLLGHVNGATVRNEDKWKPLNNPRNRDLFFRRLQAYFKGRGLDLGTFPNPFPTNENPRPLSFQSELTASASADYEEQKNSFHNYLKG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ 2.12 | 2.11847739802519 | 0.037 | 25649146 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)