Host taxon 9606
Protein NP_001041706.1
ubiquitin-like protein 5
Homo sapiens
Gene UBL5, UniProt Q9BZL1
>NP_001041706.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|ubiquitin-like protein 5
MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.58 | -0.578255589111599 | 0.012 | 25649146 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)