Host taxon 9606
Protein NP_057283.1
U6 snRNA-associated Sm-like protein LSm7
Homo sapiens
Gene LSM7, UniProt Q9UK45
>NP_057283.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|U6 snRNA-associated Sm-like protein LSm7
MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.98 | -0.976843552315148 | 0.037 | 25649146 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)