Host taxon 9606
Protein NP_009011.1
U6 snRNA-associated Sm-like protein LSm6
Homo sapiens
Gene LSM6, UniProt P62312
>NP_009011.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|U6 snRNA-associated Sm-like protein LSm6
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.1 | -1.10050845168007 | 0.00045 | 25649146 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)