Host taxon 9606
Protein NP_055278.1
U6 snRNA-associated Sm-like protein LSm3
Homo sapiens
Gene LSM3, UniProt P62310
>NP_055278.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|U6 snRNA-associated Sm-like protein LSm3
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.09 | -1.09048227120311 | 6.9e-10 | 25649146 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)