Host taxon 9606
Protein NP_003084.1
U1 small nuclear ribonucleoprotein C
Homo sapiens
Gene SNRPC, UniProt P09234
>NP_003084.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|U1 small nuclear ribonucleoprotein C
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.37 | 0.367417424469288 | 0.036 | 25649146 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)