Host taxon 9606
Protein NP_003811.2
tumor necrosis factor receptor superfamily member 14 isoform 1 precursor
Homo sapiens
Gene TNFRSF14, UniProt Q92956
>NP_003811.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|tumor necrosis factor receptor superfamily member 14 isoform 1 precursor
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 5.37 | 5.37011047712543 | 0.044 | 25649146 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)