Host taxon 9606
Protein NP_057723.1
tumor necrosis factor receptor superfamily member 12A precursor
Homo sapiens
Gene TNFRSF12A, UniProt Q9NP84
>NP_057723.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|tumor necrosis factor receptor superfamily member 12A precursor
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.65 | -0.645793257953815 | 0.02 | 25649146 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)