Host taxon 9606
Protein NP_078851.2
tumor necrosis factor alpha-induced protein 8-like protein 2
Homo sapiens
Gene TNFAIP8L2, UniProt Q6P589
>NP_078851.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|tumor necrosis factor alpha-induced protein 8-like protein 2
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.62 | 0.621399893924925 | 2.7e-8 | 25649146 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)