Host taxon 9606
Protein NP_001071122.1
tumor necrosis factor alpha-induced protein 8 isoform b
Homo sapiens
Gene TNFAIP8, UniProt O95379
>NP_001071122.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|tumor necrosis factor alpha-induced protein 8 isoform b
MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.81 | -0.8072331536015 | 2.1e-7 | 25649146 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)