Host taxon 9606
Protein NP_001273188.1
tRNA-specific adenosine deaminase 2 isoform b
Homo sapiens
Gene ADAT2, UniProt Q7Z6V5
>NP_001273188.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|tRNA-specific adenosine deaminase 2 isoform b
MVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.89 | 0.885868740335842 | 0.00075 | 25649146 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)