Host taxon 9606
Protein NP_001258750.1
triggering receptor expressed on myeloid cells 2 precursor isoform 2 precursor
Homo sapiens
Gene TREM2, UniProt Q9NZC2
>NP_001258750.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|triggering receptor expressed on myeloid cells 2 precursor isoform 2 precursor
MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRAERHVKEDDGRKSPGEVPPGTSPACILATWPPGLLVLLWQETTLPEHCFSWTLEAGTG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.55 | 0.546535308280698 | 0.019 | 25649146 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)