Host taxon 9606
Protein NP_071928.2
transmembrane protein 267
Homo sapiens
Gene TMEM267, UniProt Q0VDI3
>NP_071928.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|transmembrane protein 267
MASETEKTHALLQTCSTESLISSLGLGAFCLVADRLLQFSTIQQNDWLRALSDNAVHCVIGMWSWAVVTGIKKKTDFGEIILAGFLASVIDVDHFFLAGSMSLKAALTLPRRPFLHCSTVIPVVVLTLKFTMHLFKLKDSWCFLPWMLFISWTSHHIRDGIRHGLWICPFGKTSPLPFWLYVIITSSLPHICSFVMYLTGTRQMMSSKHGVRIDV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.5 | -0.496393893264166 | 0.003 | 25649146 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)