Host taxon 9606
Protein NP_001156551.1
transmembrane protein 121B isoform b
Homo sapiens
Gene TMEM121B, UniProt Q9BXQ6
>NP_001156551.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|transmembrane protein 121B isoform b
MALSVPLLYSLVRAISEAGAPPGSAGPLLLQPQRHRAAGCFLGTCLDLLDSFTLVELMLEGRVPLPAHLRYLLIAVYFLTLASPVLWLYELNAAAAAAASWGQASGPGSCSRLLRLLGGCLVDVPLLALRCLLVVSYQQPLSIFMLKNLFFLGCRGLEALEGCWDRGNRASPSRARGGYGAPPSAPPPPPPPPQGGSQLGHCISENEGGAHGYVNTLAVASQN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.99 | 0.991082691512756 | 0.015 | 25649146 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)