Host taxon 9606
Protein NP_057017.1
translation machinery-associated protein 7 isoform 1
Homo sapiens
Gene TMA7, UniProt Q9Y2S6
>NP_057017.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|translation machinery-associated protein 7 isoform 1
MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.89 | -0.88926724133249 | 0.001 | 25649146 | |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)