Host taxon 9606
Protein NP_001257820.1
trafficking protein particle complex subunit 6A isoform 2
Homo sapiens
Gene TRAPPC6A, UniProt O75865
>NP_001257820.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|trafficking protein particle complex subunit 6A isoform 2
MADTVLFEFLHTEMVAELWAHDPDPGPGGQKMSLSVLEGMGFRVGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.13 | -1.12677530808074 | 0.027 | 25649146 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)