Host taxon 9606
Protein NP_001305415.1
trafficking protein particle complex subunit 4 isoform 2 precursor
Homo sapiens
Gene TRAPPC4, UniProt Q9Y296
>NP_001305415.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|trafficking protein particle complex subunit 4 isoform 2 precursor
MAGTRPTGKRCWSIWVTLLITRCPFDLAGPASLLMRSLCWPPCSTRIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● -6.18 | -6.18414954379402 | 0.012 | 25649146 | |
Retrieved 1 of 4 entries in 0.8 ms
(Link to these results)