Host taxon 9606
Protein NP_114416.1
TM2 domain-containing protein 1 precursor
Homo sapiens
Gene TM2D1, UniProt Q9BX74
>NP_114416.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|TM2 domain-containing protein 1 precursor
MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.74 | -0.743896907068542 | 0.00039 | 25649146 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)