Host taxon 9606
Protein NP_066932.1
thymosin beta-4
Homo sapiens
Gene TMSB4X, UniProt P62328
>NP_066932.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|thymosin beta-4
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.97 | -0.973235347921414 | 0.021 | 25649146 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)