Host taxon 9606
Protein NP_001290400.1
thioredoxin-like protein 4A isoform 2
Homo sapiens
Gene TXNL4A, UniProt P83876
>NP_001290400.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|thioredoxin-like protein 4A isoform 2
MLLARKQILCVNVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.61 | -0.609279664578642 | 5.5e-5 | 25649146 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)