Host taxon 9606
Protein NP_001304720.1
THAP domain-containing protein 6 isoform 2
Homo sapiens
Gene THAP6, UniProt Q8TBB0
>NP_001304720.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|THAP domain-containing protein 6 isoform 2
MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.77 | 0.773675531976308 | 0.0035 | 25649146 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)