Host taxon 9606
Protein NP_004731.2
TGFB1-induced anti-apoptotic factor 1
Homo sapiens
Gene TIAF1, UniProt O95411
>NP_004731.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|TGFB1-induced anti-apoptotic factor 1
MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.7 | 1.69890038133902 | 0.019 | 25649146 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)