Host taxon 9606
Protein NP_001025010.1
T-cell activation inhibitor, mitochondrial isoform 2
Homo sapiens
Gene TCAIM, UniProt Q8N3R3
>NP_001025010.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|T-cell activation inhibitor, mitochondrial isoform 2
MFCHLRPMRRLCLEKIFPHWFPFSRALSGAEAVNALRPFYFAVHPDFFGQHPVERDDTWKSFQCPSDFSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.55 | 0.554296977152337 | 0.0053 | 25649146 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)