Host taxon 9606
Protein NP_001263432.1
succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial isoform b precursor
Homo sapiens
Gene SDHD, UniProt O14521
>NP_001263432.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial isoform b precursor
MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHWALDKLLLTMFMGMPCRKLPRQGFWHFQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.62 | 0.619421061238201 | 7.1e-6 | 25649146 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)