Host taxon 9606
Protein NP_001243117.1
sorting nexin-12 isoform 4
Homo sapiens
Gene SNX12, UniProt Q9UMY4
>NP_001243117.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|sorting nexin-12 isoform 4
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYETNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.69 | -0.692869300195688 | 0.021 | 25649146 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)