Host taxon 9606
Protein NP_001269639.1
solute carrier family 66 member 3 isoform b
Homo sapiens
Gene SLC66A3, UniProt Q8N755
>NP_001269639.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|solute carrier family 66 member 3 isoform b
MEAALLGLCNWSTLGVCAALKLPQISAVLAARSARGLSLPSLLLELAGFLVFLRYQCYYGYPPLTYLEYPILIAQDVILLLCIFHFNGNVKQATPYIAVLVSSWFILALQKWIIDLAMNLCTFISAASKFAQLQCLWKTRDSGTVSALTWSLSSYTCAILLRFVIMLALNIWVTVTVLRYRKTAIKAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.74 | 0.739599917289107 | 0.013 | 25649146 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)