Host taxon 9606
Protein NP_003087.1
small nuclear ribonucleoprotein G isoform a
Homo sapiens
Gene SNRPG, UniProt P62308
>NP_003087.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|small nuclear ribonucleoprotein G isoform a
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.79 | -0.791905417759501 | 9.6e-9 | 25649146 | |
Retrieved 1 of 4 entries in 0.8 ms
(Link to these results)