Host taxon 9606
Protein NP_001243439.1
single-stranded DNA-binding protein, mitochondrial precursor
Homo sapiens
Gene SSBP1, UniProt Q04837
>NP_001243439.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|single-stranded DNA-binding protein, mitochondrial precursor
MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.2 | -1.20158686514705 | 0.00013 | 25649146 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)