Host taxon 9606
Protein NP_001077379.1
signal-regulatory protein beta-1 isoform 2 precursor
Homo sapiens
Gene SIRPB1, UniProt O00241
>NP_001077379.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|signal-regulatory protein beta-1 isoform 2 precursor
MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREAALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.86 | 0.863391720901348 | 1.1e-5 | 25649146 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)