Host taxon 9606
Protein NP_001258847.1
signal peptidase complex catalytic subunit SEC11A isoform 5
Homo sapiens
Gene SEC11A, UniProt P67812
>NP_001258847.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|signal peptidase complex catalytic subunit SEC11A isoform 5
MIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.68 | -0.681158387248132 | 7.3e-7 | 25649146 | |
Retrieved 1 of 2 entries in 2.2 ms
(Link to these results)