Host taxon 9606
Protein NP_002995.1
secreted and transmembrane protein 1 precursor
Homo sapiens
Gene SECTM1, UniProt Q8WVN6
>NP_002995.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|secreted and transmembrane protein 1 precursor
MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 5.03 | 5.02566649306568 | 0.00014 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)