Host taxon 9606
Protein NP_659495.1
RILP-like protein 2
Homo sapiens
Gene RILPL2, UniProt Q969X0
>NP_659495.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|RILP-like protein 2
MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.97 | -0.966148093292285 | 1.2e-5 | 25649146 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)