Host taxon 9606
Protein NP_001656.2
rho-related GTP-binding protein RhoG precursor
Homo sapiens
Gene RHOG, UniProt P84095
>NP_001656.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|rho-related GTP-binding protein RhoG precursor
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.8 | 0.804012310309292 | 0.015 | 25649146 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)