Host taxon 9606
Protein NP_001005915.1
receptor tyrosine-protein kinase erbB-3 isoform s precursor
Homo sapiens
Gene ERBB3, UniProt P21860
>NP_001005915.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|receptor tyrosine-protein kinase erbB-3 isoform s precursor
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTGQFPMVPSGLTPQPAQDWYLLDDDPRLLTLSASSKVPVTLAAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.96 | -1.96084651340018 | 0.0016 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)